PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G02000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 413aa    MW: 43950.9 Da    PI: 6.7266
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G02000.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.83e-10263309551
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                      kr +r   NR +A rs +RK ++i+eLe+kv+ L++e + L  +l +
  LPERR03G02000.1 263 KRVKRVLANRQSAARSKERKMKYIAELEQKVQILQSEATNLSAQLTM 309
                      999************************************99987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-14259323IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3261324IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.38E-11263313No hitNo description
PfamPF001702.2E-8263308IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-8263312No hitNo description
CDDcd147031.56E-21264313No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MNGGGGIGDA LMQPQLMVSS SSLPMVASTF VVPEQAPAAN KTRGAGLPPT PPPPTQVMAF  60
AAQRGDVCME DSAAPPRNKA HHHRRSSSDV PFGYQLLPPL KAEAAWGAHH VSGGAGAGAG  120
DDLFNAYLNL EGLEGINSHD EGDNSRGSSI KTSGADSSEN ESEECADDTR GGSAGGGGIR  180
FWGADAGVKR SATGEPLGRH ARSLSMDSLM GKYNFASAAA NGGGGLGPNR FSLEFGSGEF  240
TPNEMRKIMA DDKLAELALA DPKRVKRVLA NRQSAARSKE RKMKYIAELE QKVQILQSEA  300
TNLSAQLTMM QRDSVGIATQ NNELKFRLQA MDQQAQLRDA LNEALTAEVQ RLKLATAHLG  360
DSCSSSSIAQ QIQLNAQNRM FQLQQQQQAT QIPFYQLQQS QQNGAAKNNE SKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2365414e-80AC236541.1 Oryza minuta clone OM__Ba0161K15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627932.10.0PREDICTED: transcription factor RF2b-like
TrEMBLA0A0D9VP060.0A0A0D9VP06_9ORYZ; Uncharacterized protein
STRINGORGLA03G0019600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-64bZIP family protein